PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_E1E541767.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 360aa    MW: 38214.3 Da    PI: 6.4286
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_E1E541767.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg W++eEde+l + ++++G+g+W++I++  g+ R++k+c++rw +yl
  Traes_2BS_E1E541767.1 14 RGLWSPEEDEKLMNHIAKYGNGCWSSIPKIAGLERCGKSCRLRWINYL 61
                           788*******************************************97 PP

2Myb_DNA-binding51.81.8e-1667111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++++eE++l+++++  lG++ W+ Ia+ ++ gRt++++k++w+++
  Traes_2BS_E1E541767.1  67 RGAFSQEEEDLIIHLHSILGNK-WSQIAAQLP-GRTDNEVKNFWNSF 111
                            89********************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.731961IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-25964IPR009057Homeodomain-like
SuperFamilySSF466893.67E-3011108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002494.4E-161461IPR001005SANT/Myb domain
CDDcd001672.45E-121761No hitNo description
PROSITE profilePS5129426.23962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
SMARTSM007172.1E-1566114IPR001005SANT/Myb domain
PfamPF002499.0E-1567110IPR001005SANT/Myb domain
CDDcd001673.31E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MSKRPGGTKK RLKRGLWSPE EDEKLMNHIA KYGNGCWSSI PKIAGLERCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIH LHSILGNKWS QIAAQLPGRT DNEVKNFWNS FIKKKLRQRG  120
IDPATHKPLA PASAPPAATP VSRSAVFSEA ELILSSPVGG QHMPPLVSAE SYVYSRGSMD  180
GAGGVVGGCS DDVSLSSLSG YNNNNQTADF AGYLDADALH GGVIPSVSSS STLNSMAGVS  240
PGGAANTNAT TDELCCNNNP SNSGSGFESS TTQSSSNHHL PWLELGSISS CTEDASGAGA  300
GADHYGAALD ELKWSDYVFD GGYQQYHQQG QCIYGDSKAA ADAAAAQFDA HGLGINWCLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3537850.0AK353785.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002L23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.11e-139PREDICTED: myb-related protein Zm1-like
TrEMBLW5BPH00.0W5BPH0_WHEAT; Uncharacterized protein
STRINGSi029872m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.33e-69myb domain protein 55
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]